21 repositories

View on GitHub

Ansible playbooks to quickly setup a homelab. The playbook will update the system, install Docker, and then deploy the Docker containers.

ansibleansible-playbookautomationcentosdebian

Docker Compose Boilerplates

dockerdocker-composehacktoberfesthacktoberfest-acceptedhacktoberfest2022

Ansible Playbooks To Turn A VPS Into A Wireguard VPN Server

ansibledevopshacktoberfesthacktoberfest-acceptedhactoberfest2022

Collection of config files for my windows terminal and starship toml config files

bashbash-scriptdotfileshacktoberfesthacktoberfest-accepted

Using Terraform to deploy a new OCI instance and point a domain to it's public IP using terraform's CloudFlare provider.

New portfolio website remade in svelte

shikisveltekittailwindcsstypescriptvercel-deployment

Python web scraper using Selenium to scrape the grades of all the students of my university and export a CSV of their registration numbers, names and grades.. Built just for fun to practice Selenium web scraping

Homelab Infra Repo Intended For Mostly Personal Use

ansibleansible-playbookdockerdocker-composehomelab

Ansible playbooks to setup and configure my Fedora workstation

A Binary Classification model to predict the survivors of the Kaggle Spaceship Titanic competition, this model currently has a score of 0.78933.

kaggle-competitionmachine-learningpandassklearn

A Kmap Solver WebApp Made With Streamlit

A Binary Classification model to predict the survivors of the Kaggle Titanic competition, this model currently has a score of 0.76315.

Profile README

A minimal minesweeper game built with flutter

✨ Cosplaying as a sysadmin

Rishav Nandi

-

2025