26 repositories

View on GitHub

Ansible playbooks to quickly setup a homelab. The playbook will update the system, install Docker, and then deploy the Docker containers.

ansibleansible-playbookautomationcentosdebian

Docker Compose Boilerplates

dockerdocker-composehacktoberfesthacktoberfest-acceptedhacktoberfest2022

Ansible Playbooks To Turn A VPS Into A Wireguard VPN Server

ansibledevopshacktoberfesthacktoberfest-acceptedhactoberfest2022

Collection of config files for my windows terminal and starship toml config files

bashbash-scriptdotfileshacktoberfesthacktoberfest-accepted

Using Terraform to deploy a new OCI instance and point a domain to it's public IP using terraform's CloudFlare provider.

New portfolio website remade in svelte

shikisveltekittailwindcsstypescriptvercel-deployment

Python web scraper using Selenium to scrape the grades of all the students of my university and export a CSV of their registration numbers, names and grades.. Built just for fun to practice Selenium web scraping

Profile README

A collection of Go projects: BitTorrent swarm, booking concurrency, encrypted file transfer, and a OnePlus Buds CLI

OCI three-node K3s cluster provisioned with Terraform and configured with Ansible

Cosplaying as a sysadmin

Rishav Nandi

-

2026